PDB entry 4inw

View 4inw on RCSB PDB site
Description: Structure of Pheromone-binding protein 1 in complex with (11Z,13Z)-hexadecadienal
Class: pheromone-binding protein
Keywords: pheromone-binding protein, Amyelois transitella, pheromone, navel orangeworm moth, AtraPBP1, pH-dependent binding
Deposited on 2013-01-07, released 2013-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: 0.161
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pheromone-binding protein 1
    Species: Amyelois transitella [TaxId:680683]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4inwa_
  • Heterogens: 1EY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4inwA (A:)
    speimkdlsinfgkaldtckkeldlpdsinedfykfwkedyeitnrltgcaikclsekle
    mvdadgklhhgnarefamkhgaddamakqlvdlihgceksippnddrcmevlsiamcfkk
    eihnlkwapnmevvvgevla