PDB entry 4ins

View 4ins on RCSB PDB site
Description: the structure of 2zn pig insulin crystals at 1.5 angstroms resolution
Deposited on 1989-07-10, released 1990-04-15
The last revision prior to the SCOP 1.55 freeze date was dated 1994-07-31, with a file datestamp of 1994-08-02.
Experiment type: -
Resolution: 1.5 Å
R-factor: 0.153
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d4ins.1
  • Chain 'B':
    Domains in SCOP 1.55: d4ins.1
  • Chain 'C':
    Domains in SCOP 1.55: d4ins.2
  • Chain 'D':
    Domains in SCOP 1.55: d4ins.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4insA (A:)
giveqcctsicslyqlenycn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4insB (B:)
fvnqhlcgshlvealylvcgergffytpka

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4insC (C:)
giveqcctsicslyqlenycn

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4insD (D:)
fvnqhlcgshlvealylvcgergffytpka