PDB entry 4in4

View 4in4 on RCSB PDB site
Description: Crystal structure of cpd 15 bound to Keap1 Kelch domain
Class: transcription
Keywords: transcription
Deposited on 2013-01-03, released 2013-05-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.194
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kelch-like ECH-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: INRF2, KEAP1, KIAA0132, KLHL19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4in4a_
  • Chain 'B':
    Compound: Kelch-like ECH-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: INRF2, KEAP1, KIAA0132, KLHL19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4in4b_
  • Chain 'C':
    Compound: Kelch-like ECH-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: INRF2, KEAP1, KIAA0132, KLHL19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4in4c_
  • Heterogens: PO4, 4ID, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4in4A (A:)
    sglvprgshmapkvgrliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvv
    ggllyavggrnnspdgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavgg
    shgcihhnsveryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecy
    ypernewrmitamntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapm
    khrrsalgitvhqgriyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4in4A (A:)
    pkvgrliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrn
    nspdgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsve
    ryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmit
    amntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgitv
    hqgriyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4in4B (B:)
    sglvprgshmapkvgrliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvv
    ggllyavggrnnspdgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavgg
    shgcihhnsveryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecy
    ypernewrmitamntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapm
    khrrsalgitvhqgriyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4in4B (B:)
    rliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrnnspd
    gntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsveryep
    erdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitamnt
    irsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgitvhqgr
    iyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4in4C (C:)
    sglvprgshmapkvgrliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvv
    ggllyavggrnnspdgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavgg
    shgcihhnsveryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecy
    ypernewrmitamntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapm
    khrrsalgitvhqgriyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4in4C (C:)
    apkvgrliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggr
    nnspdgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsv
    eryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmi
    tamntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgit
    vhqgriyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt