PDB entry 4imy

View 4imy on RCSB PDB site
Description: The AFF4 scaffold binds human P-TEFb adjacent to HIV Tat
Class: transferase
Keywords: Transcriptional CDK9-CycT1 complex, phosphorylated, intrinsically disordered AFF4, regulation of transcription elongation, Ser/Thr kinase, phosphorylation of PolII-CTD, DSIF, and NELF, HIV-1 Tat, Host-virus interaction, phosphoprotein, nucleus, TRANSFERASE
Deposited on 2013-01-03, released 2013-03-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-04-03, with a file datestamp of 2013-03-29.
Experiment type: XRAY
Resolution: 2.94 Å
R-factor: 0.209
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclin-dependent kinase 9
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK9, CDC2L4, TAK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4imya_
  • Chain 'B':
    Compound: Cyclin-T1
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4imyb1, d4imyb2
  • Chain 'C':
    Compound: Cyclin-dependent kinase 9
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK9, CDC2L4, TAK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4imyc_
  • Chain 'D':
    Compound: Cyclin-T1
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4imyd1, d4imyd2
  • Chain 'E':
    Compound: Cyclin-dependent kinase 9
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK9, CDC2L4, TAK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4imye_
  • Chain 'F':
    Compound: Cyclin-T1
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4imyf1, d4imyf2
  • Chain 'G':
    Compound: AF4/FMR2 family member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: AFF4, AF5Q31, MCEF, HSPC092
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: AF4/FMR2 family member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: AFF4, AF5Q31, MCEF, HSPC092
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: AF4/FMR2 family member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: AFF4, AF5Q31, MCEF, HSPC092
    Database cross-references and differences (RAF-indexed):
  • Heterogens: AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4imyA (A:)
    ghmakqydsvecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekeg
    fpitalreikilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvl
    vkftlseikrvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslak
    nsqpnrytnrvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhql
    alisqlcgsitpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvl
    dpaqridsddalnhdffwsdpmpsdlkgmlst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4imyA (A:)
    vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei
    kilqllkhenvvnlieicrtkgsiylvfdfcehdlagllsnvlvkftlseikrvmqmlln
    glyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytnrvvtlwyr
    ppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpevwpn
    vdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsddalnhdff
    wsdpmpsdlkgmlst
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4imyB (B:)
    megerknnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltin
    taivymhrfymiqsftqfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpd
    trseaylqqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatn
    slhlttfslqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldelthe
    flqilektpnrlkriwnwraceaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4imyB (B:)
    nnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivymh
    rfymiqsftqfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpdtrseayl
    qqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatnslhlttf
    slqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldeltheflqilek
    tpnrlkriwn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4imyC (C:)
    ghmakqydsvecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekeg
    fpitalreikilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvl
    vkftlseikrvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslak
    nsqpnrytnrvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhql
    alisqlcgsitpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvl
    dpaqridsddalnhdffwsdpmpsdlkgmlst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4imyC (C:)
    vecpfcdevskyeklakiggevfkarhrktgqkvalkkvlmenekegfpitalreikilq
    llkhenvvnlieicrtkgsiylvfdfcehdlagllsnvlvkftlseikrvmqmllnglyy
    ihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytnrvvtlwyrppel
    llgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpevwpnvdny
    elyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsddalnhdffwsdp
    mpsdlkgmlst
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4imyD (D:)
    megerknnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltin
    taivymhrfymiqsftqfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpd
    trseaylqqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatn
    slhlttfslqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldelthe
    flqilektpnrlkriwnwraceaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4imyD (D:)
    nnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivym
    hrfymiqsftqfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpdtrseay
    lqqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatnslhltt
    fslqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldeltheflqile
    ktpnrlkriwn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4imyE (E:)
    ghmakqydsvecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekeg
    fpitalreikilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvl
    vkftlseikrvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslak
    nsqpnrytnrvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhql
    alisqlcgsitpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvl
    dpaqridsddalnhdffwsdpmpsdlkgmlst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4imyE (E:)
    vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei
    kilqllkhenvvnlieicrtksiylvfdfcehdlagllsnvlvkftlseikrvmqmllng
    lyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytnrvvtlwyrp
    pelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpevwpnv
    dnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsddalnhdffw
    sdpmpsdlkgmlst
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4imyF (F:)
    megerknnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltin
    taivymhrfymiqsftqfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpd
    trseaylqqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatn
    slhlttfslqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldelthe
    flqilektpnrlkriwnwraceaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4imyF (F:)
    nnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivymh
    rfymiqsftqfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpdtrseayl
    qqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatnslhlttf
    slqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldeltheflqilek
    tpnrlkriw
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.