PDB entry 4imk

View 4imk on RCSB PDB site
Description: Uncrossed Fab binding to human Angiopoietin 2
Class: immune system
Keywords: antigen-binding fragment (Fab), human Angiopoietin 2, IMMUNE SYSTEM
Deposited on 2013-01-03, released 2013-04-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4IMK (0-End)
  • Chain 'B':
    Compound: heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4IMK (0-229)
  • Chain 'C':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4IMK
    Domains in SCOPe 2.06: d4imkc1, d4imkc2
  • Chain 'D':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4IMK
    Domains in SCOPe 2.06: d4imkd1, d4imkd2
  • Heterogens: NA, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4imkC (C:)
    qpgltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsssdhyvfgtgtkvtvlrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgecgsghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4imkC (C:)
    gltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiperfs
    gsnsgntatltisrveagdeadyycqvwdsssdhyvfgtgtkvtvlrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4imkD (D:)
    qpgltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsssdhyvfgtgtkvtvlrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgecgsghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4imkD (D:)
    gltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiperfs
    gsnsgntatltisrveagdeadyycqvwdsssdhyvfgtgtkvtvlrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnr