PDB entry 4imc

View 4imc on RCSB PDB site
Description: Crystal Structure of Pasteurella multocida N-Acetyl-D-Neuraminic acid lyase
Class: lyase
Keywords: Tim barrel, Schiff base, LYASE
Deposited on 2013-01-02, released 2013-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.174
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n-acetylneuraminate lyase
    Species: Pasteurella multocida subsp. gallicida [TaxId:1169409]
    Gene: nanA, PM1715
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CKB0 (Start-292)
      • see remark 999 (277)
    Domains in SCOPe 2.07: d4imca_
  • Chain 'B':
    Compound: n-acetylneuraminate lyase
    Species: Pasteurella multocida subsp. gallicida [TaxId:1169409]
    Gene: nanA, PM1715
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CKB0 (Start-292)
      • see remark 999 (277)
    Domains in SCOPe 2.07: d4imcb_
  • Chain 'C':
    Compound: n-acetylneuraminate lyase
    Species: Pasteurella multocida subsp. gallicida [TaxId:1169409]
    Gene: nanA, PM1715
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CKB0 (Start-292)
      • see remark 999 (277)
    Domains in SCOPe 2.07: d4imcc_
  • Chain 'D':
    Compound: n-acetylneuraminate lyase
    Species: Pasteurella multocida subsp. gallicida [TaxId:1169409]
    Gene: nanA, PM1715
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CKB0 (Start-292)
      • see remark 999 (277)
    Domains in SCOPe 2.07: d4imcd_
  • Heterogens: PO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4imcA (A:)
    mknlkgifsallvsfnadgsinekglrqivrynidkmkvdglyvggstgenfmlsteekk
    eifriakdeakdeialiaqvgsvnlqeaielgkyatelgydslsavtpfyykfsfpeikh
    yydsiieatgnymivysipfltgvnigveqfgelyknpkvlgvkftagdfyllerlkkay
    pnhliwagfdemmlpaaslgvdgaigstfnvngvrarqifeltqagklkealeiqhvtnd
    liegilanglyltikellkldgveagycrepmtkelssekvafakelkakyls
    

    Sequence, based on observed residues (ATOM records): (download)
    >4imcA (A:)
    knlkgifsallvsfnadgsinekglrqivrynidkmkvdglyvggstgenfmlsteekke
    ifriakdeakdeialiaqvgsvnlqeaielgkyatelgydslsavtpfyykfsfpeikhy
    ydsiieatgnymivysipfltgvnigveqfgelyknpkvlgvkftagdfyllerlkkayp
    nhliwagfdemmlpaaslgvdgaigstfnvngvrarqifeltqagklkealeiqhvtndl
    iegilanglyltikellkldgveagycrepmtkelssekvafakelkakyls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4imcB (B:)
    mknlkgifsallvsfnadgsinekglrqivrynidkmkvdglyvggstgenfmlsteekk
    eifriakdeakdeialiaqvgsvnlqeaielgkyatelgydslsavtpfyykfsfpeikh
    yydsiieatgnymivysipfltgvnigveqfgelyknpkvlgvkftagdfyllerlkkay
    pnhliwagfdemmlpaaslgvdgaigstfnvngvrarqifeltqagklkealeiqhvtnd
    liegilanglyltikellkldgveagycrepmtkelssekvafakelkakyls
    

    Sequence, based on observed residues (ATOM records): (download)
    >4imcB (B:)
    knlkgifsallvsfnadgsinekglrqivrynidkmkvdglyvggstgenfmlsteekke
    ifriakdeakdeialiaqvgsvnlqeaielgkyatelgydslsavtpfyykfsfpeikhy
    ydsiieatgnymivysipfltgvnigveqfgelyknpkvlgvkftagdfyllerlkkayp
    nhliwagfdemmlpaaslgvdgaigstfnvngvrarqifeltqagklkealeiqhvtndl
    iegilanglyltikellkldgveagycrepmtkelssekvafakelkakyls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4imcC (C:)
    mknlkgifsallvsfnadgsinekglrqivrynidkmkvdglyvggstgenfmlsteekk
    eifriakdeakdeialiaqvgsvnlqeaielgkyatelgydslsavtpfyykfsfpeikh
    yydsiieatgnymivysipfltgvnigveqfgelyknpkvlgvkftagdfyllerlkkay
    pnhliwagfdemmlpaaslgvdgaigstfnvngvrarqifeltqagklkealeiqhvtnd
    liegilanglyltikellkldgveagycrepmtkelssekvafakelkakyls
    

    Sequence, based on observed residues (ATOM records): (download)
    >4imcC (C:)
    knlkgifsallvsfnadgsinekglrqivrynidkmkvdglyvggstgenfmlsteekke
    ifriakdeakdeialiaqvgsvnlqeaielgkyatelgydslsavtpfyykfsfpeikhy
    ydsiieatgnymivysipfltgvnigveqfgelyknpkvlgvkftagdfyllerlkkayp
    nhliwagfdemmlpaaslgvdgaigstfnvngvrarqifeltqagklkealeiqhvtndl
    iegilanglyltikellkldgveagycrepmtkelssekvafakelkakyls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4imcD (D:)
    mknlkgifsallvsfnadgsinekglrqivrynidkmkvdglyvggstgenfmlsteekk
    eifriakdeakdeialiaqvgsvnlqeaielgkyatelgydslsavtpfyykfsfpeikh
    yydsiieatgnymivysipfltgvnigveqfgelyknpkvlgvkftagdfyllerlkkay
    pnhliwagfdemmlpaaslgvdgaigstfnvngvrarqifeltqagklkealeiqhvtnd
    liegilanglyltikellkldgveagycrepmtkelssekvafakelkakyls
    

    Sequence, based on observed residues (ATOM records): (download)
    >4imcD (D:)
    knlkgifsallvsfnadgsinekglrqivrynidkmkvdglyvggstgenfmlsteekke
    ifriakdeakdeialiaqvgsvnlqeaielgkyatelgydslsavtpfyykfsfpeikhy
    ydsiieatgnymivysipfltgvnigveqfgelyknpkvlgvkftagdfyllerlkkayp
    nhliwagfdemmlpaaslgvdgaigstfnvngvrarqifeltqagklkealeiqhvtndl
    iegilanglyltikellkldgveagycrepmtkelssekvafakelkakyls