PDB entry 4im7

View 4im7 on RCSB PDB site
Description: Crystal structure of fructuronate reductase (ydfI) from E. coli CFT073 (EFI TARGET EFI-506389) complexed with NADH and D-mannonate
Class: oxidoreductase
Keywords: rossmann fold, OXIDOREDUCTASE
Deposited on 2013-01-02, released 2013-01-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.15
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical oxidoreductase ydfI
    Species: Escherichia coli [TaxId:199310]
    Gene: c1968, ydfI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4im7a1, d4im7a2
  • Heterogens: CS2, NAI, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4im7A (A:)
    mgsshhhhhhssglvprgshmgnhllsakatlpvydrnnlaprivhlgfgafhrahqgvy
    adilatehfsdwgyyevnliggeqqiadlqqqdnlytvaemsadawtarvvgvvkkalhv
    qidgletvlaamcepqiaivsltitekgyfhspatgqlmldhpmvvadvqnphqpktatg
    vivealarrkaaglpaftvmscdnmpenghvmrdvvtsyaqaidvklaqwiednvtfpst
    mvdrivpavtedtlakieqltgvrdaagvacepfrqwviednfvagrpewekagaelvsd
    vlpyeemklrmlngshsflaylgylagyqhindcmedehyrhaaytlmlqeqaptlkvqg
    vdlqdyanrlierysnpalrhrtwqiamdgsqklpqrmldsvrwhlahdskfdllalgva
    gwmryvggvdeqgnpieisdpllpviqkavqssaegtarvqsllaikaifgddlpgnslf
    ttkvteaylsllahgakatvakysvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4im7A (A:)
    hllsakatlpvydrnnlaprivhlgfgafhrahqgvyadilatehfsdwgyyevnligge
    qqiadlqqqdnlytvaemsadawtarvvgvvkkalhvqidgletvlaamcepqiaivslt
    itekgyfhspatgqlmldhpmvvadvqnphqpktatgvivealarrkaaglpaftvmscd
    nmpenghvmrdvvtsyaqaidvklaqwiednvtfpstmvdrivpavtedtlakieqltgv
    rdaagvacepfrqwviednfvagrpewekagaelvsdvlpyeemklrmlngshsflaylg
    ylagyqhindcmedehyrhaaytlmlqeqaptlkvqgvdlqdyanrlierysnpalrhrt
    wqiamdgsqklpqrmldsvrwhlahdskfdllalgvagwmryvggvdeqgnpieisdpll
    pviqkavqssaegtarvqsllaikaifgddlpgnslfttkvteaylsllahgakatvaky
    svk