PDB entry 4ily

View 4ily on RCSB PDB site
Description: Abundantly secreted chitosanase from Streptomyces sp. SirexAA-E
Class: hydrolase
Keywords: Chitosanase, chitosan, biomass degradation, HYDROLASE
Deposited on 2013-01-01, released 2014-01-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.159
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chitosanase
    Species: Streptomyces sp. SirexAA-E [TaxId:862751]
    Gene: SACTE_5457
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ilya_
  • Chain 'B':
    Compound: Chitosanase
    Species: Streptomyces sp. SirexAA-E [TaxId:862751]
    Gene: SACTE_5457
    Database cross-references and differences (RAF-indexed):
    • Uniprot G2NRC4 (1-249)
      • expression tag (0)
    Domains in SCOPe 2.06: d4ilyb1, d4ilyb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ilyA (A:)
    saptqpaahhleaaatglddpakkdiamqlvssaenstldwkaqygyiedigdgrgytag
    iigfcsgtgdmlalverytdrspgnvlasylpalrevdgtdshdgldpgfprdwaeaakd
    pvfqqaqnderdrvyfdpavrqakddglgtlgqfayydaivmhggggdstsfgsirqral
    aeaeppsrggdevayldafldarvwamrqeeahsdtsrvdtaqrvflrdgnlnldppldw
    qvygdsfhig
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ilyA (A:)
    atglddpakkdiamqlvssaenstldwkaqygyiedigdgrgytagiigfcsgtgdmlal
    verytdrspgnvlasylpalrevdgtdshdgldpgfprdwaeaakdpvfqqaqnderdrv
    yfdpavrqakddglgtlgqfayydaivmhggggdstsfgsirqralaeaeppsrggdeva
    yldafldarvwamrqeeahsdtsrvdtaqrvflrdgnlnldppldwqvygdsfhig
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ilyB (B:)
    saptqpaahhleaaatglddpakkdiamqlvssaenstldwkaqygyiedigdgrgytag
    iigfcsgtgdmlalverytdrspgnvlasylpalrevdgtdshdgldpgfprdwaeaakd
    pvfqqaqnderdrvyfdpavrqakddglgtlgqfayydaivmhggggdstsfgsirqral
    aeaeppsrggdevayldafldarvwamrqeeahsdtsrvdtaqrvflrdgnlnldppldw
    qvygdsfhig