PDB entry 4ilh

View 4ilh on RCSB PDB site
Description: Crystal structure of an Aar2p C-terminal deletion mutant in conplex with Prp8p RNaseH
Class: splicing
Keywords: U5 snRNP assembly, Aar2, Prp8, SPLICING
Deposited on 2012-12-31, released 2013-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.17
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-mRNA-splicing factor 8
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: PRP8, DBF3, DNA39, RNA8, SLT21, USA2, YHR165C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33334 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4ilha1, d4ilha2
  • Chain 'B':
    Compound: A1 cistron-splicing factor AAR2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: AAR2, YBL074C, YBL06.06, YBL0611
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ilhb1, d4ilhb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ilhA (A:)
    gamnssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflk
    iihtsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfp
    niairptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlll
    ralktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynvnis
    altqteikdiilgqnika
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ilhA (A:)
    gamnssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflk
    iihtsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfp
    niairptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlll
    ralktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynvnis
    altqteikdiilgqn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ilhB (B:)
    mntvpftsapievtigidqysfnvkenqpfhgikdipighvhvihfqhadnssmrygywf
    dcrmgnfyiqydpkdglykmmeerdgakfenivhnfkerqmmvsypkideddtwynltef
    vqmdkirkivrkdenqfsyvdssmttvqenellksslqkagskmeakneddpahslnytv
    infksreairpghemedfldksyylntvmlqgifknssnyfgelqfaflnamffgnygss
    lqwhamielicssatvpkhmldkldeilyyqiktlpeqysdillnervwniclyssfqkn
    slhntekimenkypellgkdneddaliygislehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ilhB (B:)
    mntvpftsapievtigidqysfnvkenqpfhgikdipighvhvihfqhadnssmrygywf
    dcrmgnfyiqydpkdglykmmeerdgakfenivhnfkerqmmvsypkideddtwynltef
    vqmdkirkivrkdenqfsyvdssmttvqenehslnytvinfksreairpghemedfldks
    yylntvmlqgifknssnyfgelqfaflnamffgnygsslqwhamielicssatvpkhmld
    kldeilyyqiktlpeqysdillnervwniclyssfqknslhntekimenkypell