PDB entry 4ijz

View 4ijz on RCSB PDB site
Description: Crystal structure of diaminopimelate epimerase from Escherichia coli
Class: isomerase
Keywords: DAP epimerase-like, Isomerase
Deposited on 2012-12-24, released 2013-02-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.165
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diaminopimelate epimerase
    Species: Escherichia coli [TaxId:83333]
    Gene: DAPF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4ijza1, d4ijza2
  • Chain 'B':
    Compound: Diaminopimelate epimerase
    Species: Escherichia coli [TaxId:83333]
    Gene: DAPF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6K1 (0-273)
      • expression tag (274)
    Domains in SCOPe 2.04: d4ijzb1, d4ijzb2
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ijzA (A:)
    mqfskmhglgndfmvvdavtqnvffspelirrladrhlgvgfdqllvveppydpeldfhy
    rifnadgsevaqcgngarcfarfvrlkgltnkrdirvstangrmvltvtdddlvrvnmge
    pnfepsavpfrankaektyimraaeqtilcgvvsmgnphcviqvddvdtaavetlgpvle
    sherfperanigfmqvvkrehirlrvyergagetqacgsgacaavavgiqqgllaeevrv
    elpggrldiawkgpghplymtgpavhvydgfihlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ijzA (A:)
    mqfskmhglgndfmvvdavtqnvffspelirrladrhlgvgfdqllvveppydpeldfhy
    rifnadgsevaqcgngarcfarfvrlkgltnkrdirvstangrmvltvtdddlvrvnmge
    pnfepsavpfrankaektyimraaeqtilcgvvsmgnphcviqvddvdtaavetlgpvle
    sherfperanigfmqvvkrehirlrvyergagetqacgsgacaavavgiqqgllaeevrv
    elpggrldiawkgpghplymtgpavhvydgfihl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ijzB (B:)
    mqfskmhglgndfmvvdavtqnvffspelirrladrhlgvgfdqllvveppydpeldfhy
    rifnadgsevaqcgngarcfarfvrlkgltnkrdirvstangrmvltvtdddlvrvnmge
    pnfepsavpfrankaektyimraaeqtilcgvvsmgnphcviqvddvdtaavetlgpvle
    sherfperanigfmqvvkrehirlrvyergagetqacgsgacaavavgiqqgllaeevrv
    elpggrldiawkgpghplymtgpavhvydgfihlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ijzB (B:)
    mqfskmhglgndfmvvdavtqnvffspelirrladrhlgvgfdqllvveppydpeldfhy
    rifnadgsevaqcgngarcfarfvrlkgltnkrdirvstangrmvltvtdddlvrvnmge
    pnfepsavpfrankaektyimraaeqtilcgvvsmgnphcviqvddvdtaavetlgpvle
    sherfperanigfmqvvkrehirlrvyergagetqacgsgacaavavgiqqgllaeevrv
    elpggrldiawkgpghplymtgpavhvydgfihlh