PDB entry 4ijo

View 4ijo on RCSB PDB site
Description: Unraveling hidden allosteric regulatory sites in structurally homologues metalloproteases
Class: hydrolase
Keywords: Matrix Metalloproteinase, Hydrolase, Degradation of the extracellular matrix proteins, Amphiphols, regulatory sites, Extracellular
Deposited on 2012-12-22, released 2013-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Macrophage metalloelastase
  Species: Homo sapiens [TaxId:9606]
  Gene: MMP12, HME
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39900 (0-157)
    • engineered mutation (65)
  Domains in SCOPe 2.07: d4ijoa_
• Heterogens: ZN, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4ijoA (A:)
  gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
  gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
  lghssdpkavmfptykyvdintfrlsaddirgiqslyg