PDB entry 4ijo

View 4ijo on RCSB PDB site
Description: Unraveling hidden allosteric regulatory sites in structurally homologues metalloproteases
Class: hydrolase
Keywords: Matrix Metalloproteinase, Hydrolase, Degradation of the extracellular matrix proteins, Amphiphols, regulatory sites, Extracellular
Deposited on 2012-12-22, released 2013-05-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-07-31, with a file datestamp of 2013-07-26.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.188
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (0-157)
      • engineered mutation (65)
    Domains in SCOPe 2.05: d4ijoa_
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ijoA (A:)
    gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
    gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
    lghssdpkavmfptykyvdintfrlsaddirgiqslyg