PDB entry 4ijk

View 4ijk on RCSB PDB site
Description: Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from Helicobacter pylori 26695
Class: oxidoreductase
Keywords: structural genomics, Center for Structural Genomics of Infectious Diseases, CSGID, short chain dehydrogenase, FabG, beta-ketoacyl-acyl carrier protein reductase, OXIDOREDUCTASE
Deposited on 2012-12-21, released 2013-01-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-01-09, with a file datestamp of 2013-01-04.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.237
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-ketoacyl-acyl carrier protein reductase (FabG)
    Species: Helicobacter pylori [TaxId:85962]
    Gene: HP0561, HP_0561
    Database cross-references and differences (RAF-indexed):
    • Uniprot O25286 (24-270)
      • expression tag (23)
    Domains in SCOPe 2.05: d4ijka_
  • Chain 'B':
    Compound: 3-ketoacyl-acyl carrier protein reductase (FabG)
    Species: Helicobacter pylori [TaxId:85962]
    Gene: HP0561, HP_0561
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ijkb_
  • Chain 'C':
    Compound: 3-ketoacyl-acyl carrier protein reductase (FabG)
    Species: Helicobacter pylori [TaxId:85962]
    Gene: HP0561, HP_0561
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ijkc_
  • Chain 'D':
    Compound: 3-ketoacyl-acyl carrier protein reductase (FabG)
    Species: Helicobacter pylori [TaxId:85962]
    Gene: HP0561, HP_0561
    Database cross-references and differences (RAF-indexed):
    • Uniprot O25286 (24-End)
      • expression tag (23)
    Domains in SCOPe 2.05: d4ijkd_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ijkA (A:)
    mhhhhhhssgvdlgtenlyfqsnamqftgknvlitgaskgigaeiaktlasmglkvwiny
    rsnaevadalkneleekgykaavikfdaasesdfieaiqtivqsdgglsylvnnagvvrd
    klaikmktedfhhvidnnltsafigcrealkvmsksrfgsvvnvasiigergnmgqtnys
    askggmiamsksfayegalrnirfnsvtpgfietdmnanlkdelkadyvkniplnrlgsa
    kevaeavafllsdhssyitgetlkvngglym
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ijkA (A:)
    amqftgknvlitgaskgigaeiaktlasmglkvwinyrsnaevadalkneleekgykaav
    ikfdaasesdfieaiqtivqsdgglsylvnnagvvrdklaikmktedfhhvidnnltsaf
    igcrealkvmsksrfgsvvnvasiigergnmgqtnysaskggmiamsksfayegalrnir
    fnsvtpgfietdyvkniplnrlgsakevaeavafllsdhssyitgetlkvngglym
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ijkB (B:)
    mhhhhhhssgvdlgtenlyfqsnamqftgknvlitgaskgigaeiaktlasmglkvwiny
    rsnaevadalkneleekgykaavikfdaasesdfieaiqtivqsdgglsylvnnagvvrd
    klaikmktedfhhvidnnltsafigcrealkvmsksrfgsvvnvasiigergnmgqtnys
    askggmiamsksfayegalrnirfnsvtpgfietdmnanlkdelkadyvkniplnrlgsa
    kevaeavafllsdhssyitgetlkvngglym
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ijkB (B:)
    mqftgknvlitgaskgigaeiaktlasmglkvwinyrsnaevadalkneleekgykaavi
    kfdaasesdfieaiqtivqsdgglsylvnnagvvrdklaikmktedfhhvidnnltsafi
    gcrealkvmsksrfgsvvnvasmgqtnysaskggmiamsksfayegalrnirfnsvtpgf
    ietvkniplnrlgsakevaeavafllsdhssyitgetlkvnggly
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ijkC (C:)
    mhhhhhhssgvdlgtenlyfqsnamqftgknvlitgaskgigaeiaktlasmglkvwiny
    rsnaevadalkneleekgykaavikfdaasesdfieaiqtivqsdgglsylvnnagvvrd
    klaikmktedfhhvidnnltsafigcrealkvmsksrfgsvvnvasiigergnmgqtnys
    askggmiamsksfayegalrnirfnsvtpgfietdmnanlkdelkadyvkniplnrlgsa
    kevaeavafllsdhssyitgetlkvngglym
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ijkC (C:)
    mqftgknvlitgaskgigaeiaktlasmglkvwinyrsnaevadalkneleekgykaavi
    kfdaasesdfieaiqtivqsdgglsylvnnagvvrdklaikmktedfhhvidnnltsafi
    gcrealkvmsksrfgsvvnvasiigergnmgqtnysaskggmiamsksfayegalrnirf
    nsvtpgfietdadyvkniplnrlgsakevaeavafllsdhssyitgetlkvngglym
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ijkD (D:)
    mhhhhhhssgvdlgtenlyfqsnamqftgknvlitgaskgigaeiaktlasmglkvwiny
    rsnaevadalkneleekgykaavikfdaasesdfieaiqtivqsdgglsylvnnagvvrd
    klaikmktedfhhvidnnltsafigcrealkvmsksrfgsvvnvasiigergnmgqtnys
    askggmiamsksfayegalrnirfnsvtpgfietdmnanlkdelkadyvkniplnrlgsa
    kevaeavafllsdhssyitgetlkvngglym
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ijkD (D:)
    amqftgknvlitgaskgigaeiaktlasmglkvwinyrsnaevadalkneleekgykaav
    ikfdaasesdfieaiqtivqsdgglsylvnnagvvrdklaikmktedfhhvidnnltsaf
    igcrealkvmsksrfgsvvnvagnmgqtnysaskggmiamsksfayegalrnirfnsvtp
    gfieadyvkniplnrlgsakevaeavafllsdhssyitgetlkvnggly