PDB entry 4ijh

View 4ijh on RCSB PDB site
Description: Fragment-based Discovery of Protein-Protein Interaction Inhibitors of Replication Protein A
Class: DNA binding protein/inhibitor
Keywords: OB-Fold, Protein-Protein Interaction, DNA BINDING PROTEIN-INHIBITOR complex
Deposited on 2012-12-21, released 2013-08-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.151
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replication protein A 70 kDa DNA-binding subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: REPA1, RPA1, RPA70
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27694 (3-122)
      • expression tag (0-2)
      • engineered mutation (9)
    Domains in SCOPe 2.05: d4ijha_
  • Heterogens: 1EJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ijhA (A:)
    gshmvgqlsrgaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfm
    latqlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvp
    yne