PDB entry 4iiv

View 4iiv on RCSB PDB site
Description: Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from Escherichia coli strain CFT073 complexed with NADP+ at 2.5 A resolution
Class: oxidoreductase
Keywords: structural genomics, Center for Structural Genomics of Infectious Diseases, CSGID, short chain dehydrogenase, FabG, beta-ketoacyl-acyl carrier protein reductase, Rossmann fold, OXIDOREDUCTASE
Deposited on 2012-12-20, released 2013-01-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-01-09, with a file datestamp of 2013-01-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.182
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Escherichia coli [TaxId:199310]
    Gene: c1187, NT04EC1225
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8FJ14 (Start-266)
      • engineered mutation (43)
    Domains in SCOPe 2.05: d4iiva_
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Escherichia coli [TaxId:199310]
    Gene: c1187, NT04EC1225
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8FJ14 (Start-266)
      • engineered mutation (43)
    Domains in SCOPe 2.05: d4iivb_
  • Chain 'C':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Escherichia coli [TaxId:199310]
    Gene: c1187, NT04EC1225
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8FJ14 (Start-266)
      • engineered mutation (43)
    Domains in SCOPe 2.05: d4iivc_
  • Chain 'D':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Escherichia coli [TaxId:199310]
    Gene: c1187, NT04EC1225
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8FJ14 (Start-266)
      • engineered mutation (43)
    Domains in SCOPe 2.05: d4iivd_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iivA (A:)
    mhhhhhhssgvdlgtenlyfqsnamsrsvlvtgaskgigraiarqlaadgfnigvhyhrd
    aagaqetlnaivanggngrllsfdvanreqcrevleheiaqhgawygvvsnagiardaaf
    palsnddwdavihtnldsfynviqpcimpmigarqggriitlssvsgvmgnrgqvnysaa
    kagiigatkalaielakrkitvnciapglidtgmiemeesalkeamsmipmkrmgqaeev
    aglasylmsdiagyvtrqvisinggml
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iivA (A:)
    srsvlvtgaskgigraiarqlaadgfnigvhyhrdaagaqetlnaivanggngrllsfdv
    anreqcrevleheiaqhgawygvvsnagiardaafpalsnddwdavihtnldsfynviqp
    cimpmigarqggriitlssvsgvmgnrgqvnysaakagiigatkalaielakrkitvnci
    apglidtgmiemeesalkeamsmipmkrmgqaeevaglasylmsdiagyvtrqvisingg
    ml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4iivB (B:)
    mhhhhhhssgvdlgtenlyfqsnamsrsvlvtgaskgigraiarqlaadgfnigvhyhrd
    aagaqetlnaivanggngrllsfdvanreqcrevleheiaqhgawygvvsnagiardaaf
    palsnddwdavihtnldsfynviqpcimpmigarqggriitlssvsgvmgnrgqvnysaa
    kagiigatkalaielakrkitvnciapglidtgmiemeesalkeamsmipmkrmgqaeev
    aglasylmsdiagyvtrqvisinggml
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iivB (B:)
    srsvlvtgaskgigraiarqlaadgfnigvhyhrdaagaqetlnaivanggngrllsfdv
    anreqcrevleheiaqhgawygvvsnagiardaafpalsnddwdavihtnldsfynviqp
    cimpmigarqggriitlssvsgvmgnrgqvnysaakagiigatkalaielakrkitvnci
    apglidtmeesalkeamsmipmkrmgqaeevaglasylmsdiagyvtrqvisinggml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4iivC (C:)
    mhhhhhhssgvdlgtenlyfqsnamsrsvlvtgaskgigraiarqlaadgfnigvhyhrd
    aagaqetlnaivanggngrllsfdvanreqcrevleheiaqhgawygvvsnagiardaaf
    palsnddwdavihtnldsfynviqpcimpmigarqggriitlssvsgvmgnrgqvnysaa
    kagiigatkalaielakrkitvnciapglidtgmiemeesalkeamsmipmkrmgqaeev
    aglasylmsdiagyvtrqvisinggml
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iivC (C:)
    srsvlvtgaskgigraiarqlaadgfnigvhyhrdaagaqetlnaivanggngrllsfdv
    anreqcrevleheiaqhgawygvvsnagiardaafpalsnddwdavihtnldsfynviqp
    cimpmigarqggriitlssvsgvmgnrgqvnysaakagiigatkalaielakrkitvnci
    apglidtgmiemeesalkeamsmipmkrmgqaeevaglasylmsdiagyvtrqvisingg
    ml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4iivD (D:)
    mhhhhhhssgvdlgtenlyfqsnamsrsvlvtgaskgigraiarqlaadgfnigvhyhrd
    aagaqetlnaivanggngrllsfdvanreqcrevleheiaqhgawygvvsnagiardaaf
    palsnddwdavihtnldsfynviqpcimpmigarqggriitlssvsgvmgnrgqvnysaa
    kagiigatkalaielakrkitvnciapglidtgmiemeesalkeamsmipmkrmgqaeev
    aglasylmsdiagyvtrqvisinggml
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iivD (D:)
    srsvlvtgaskgigraiarqlaadgfnigvhyhrdaagaqetlnaivanggngrllsfdv
    anreqcrevleheiaqhgawygvvsnagiardaafpalsnddwdavihtnldsfynviqp
    cimpmigarqggriitlssvsgvmgnrgqvnysaakagiigatkalaielakrkitvnci
    apglidtgmiemeesalkeamsmipmkrmgqaeevaglasylmsdiagyvtrqvisingg
    ml