PDB entry 4ii3

View 4ii3 on RCSB PDB site
Description: Crystal structure of S. pombe Ubiquitin activating enzyme 1 (Uba1) in complex with ubiquitin and ATP/Mg
Class: ligase
Keywords: Rossmann-like Fold, ubiquitin-like fold, Ubiquitin activating enzyme activity, ATP binding, Ligase activity, ATP/Mg binding, Ubiquitin E2 binding, LIGASE
Deposited on 2012-12-19, released 2013-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-activating enzyme E1 1
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: ptr3, SPBC1604.21c, SPBC211.09, Ubiquitin activating enzyme 1 (Uba1)
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ubiquitin-60s ribosomal protein l40
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: ubi2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ii3b_
  • Chain 'C':
    Compound: Ubiquitin-activating enzyme E1 1
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: ptr3, SPBC1604.21c, SPBC211.09, Ubiquitin activating enzyme 1 (Uba1)
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: ubiquitin-60s ribosomal protein l40
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: ubi2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ii3d_
  • Heterogens: MG, ATP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ii3B (B:)
    mgsshhhhhhssglvprgshmqifvktltgktitlevessdtidnvkskiqdkegippdq
    qrlifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ii3B (B:)
    mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ii3D (D:)
    mgsshhhhhhssglvprgshmqifvktltgktitlevessdtidnvkskiqdkegippdq
    qrlifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ii3D (D:)
    mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg