PDB entry 4ii2

View 4ii2 on RCSB PDB site
Description: Crystal structure of Ubiquitin activating enzyme 1 (Uba1) in complex with the Ub E2 Ubc4, ubiquitin, and ATP/Mg
Class: ligase
Keywords: ubiquitin, E1, E2, Uba1, Ubc4, conformational change, thioester, adenylation, thioester transfer (transthioesterification), ATP-binding, Rossmann-like Fold, ubiquitin-like fold, Ligase activity, ATP/Mg binding, Ubiquitin E2 binding, ubiquitination, nucleus, LIGASE
Deposited on 2012-12-19, released 2013-02-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.213
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ubiquitin-activating enzyme E1 1
  Species: Schizosaccharomyces pombe [TaxId:284812]
  Gene: ptr3, SPBC1604.21c, SPBC211.09, Ubiquitin activating enzyme 1 (Uba1)
  Database cross-references and differences (RAF-indexed):
  • Uniprot O94609 (1-1000)
• Chain 'B':
  Compound: ubiquitin-60s ribosomal protein l40
  Species: Schizosaccharomyces pombe [TaxId:284812]
  Gene: ubi2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CH07 (7-82)
    • expression tag (3-6)
    • engineered mutation (12)
    • engineered mutation (17)
    • engineered mutation (33-35)
    • engineered mutation (39)
    • engineered mutation (54)
    • engineered mutation (63)
    • engineered mutation (69)
  Domains in SCOPe 2.04: d4ii2b_
• Chain 'C':
  Compound: Ubiquitin-conjugating enzyme E2 4
  Species: Schizosaccharomyces pombe [TaxId:284812]
  Gene: SPBC119.02, ubc4, Ubiquitin conjugating enzyme 4 (Ubc4)
  Database cross-references and differences (RAF-indexed):
  • Uniprot P46595 (0-146)
    • engineered mutation (20)
    • engineered mutation (106)
    • expression tag (147-148)
  Domains in SCOPe 2.04: d4ii2c_
• Heterogens: MG, ATP, PG0, EDO, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >4ii2B (B:)
  mhhhhhhmqifvrtltgrtitlevessdtidnvrariqdregippdqqrlifagrqledg
  rtladyniqrestlhlvlrlrgg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4ii2B (B:)
  hhhhmqifvrtltgrtitlevessdtidnvrariqdregippdqqrlifagrqledgrtl
  adyniqrestlhlvlrlrgg
  

  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >4ii2C (C:)
  malkrinreladlgkdppssssagpvgddlfhwqatimgpadspyaggvfflsihfptdy
  pfkppkvnfttriyhpninsngsicldilrdqwspaltiskvllsisslltdpnpddplv
  peiahvyktdrsryelsarewtrkyaihggegaaalehhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4ii2C (C:)
  malkrinreladlgkdppssssagpvgddlfhwqatimgpadspyaggvfflsihfptdy
  pfkppkvnfttriyhpninsngsicldilrdqwspaltiskvllsisslltdpnpddplv
  peiahvyktdrsryelsarewtrkyaihg