PDB entry 4ii2

View 4ii2 on RCSB PDB site
Description: Crystal structure of Ubiquitin activating enzyme 1 (Uba1) in complex with the Ub E2 Ubc4, ubiquitin, and ATP/Mg
Class: ligase
Keywords: ubiquitin, E1, E2, Uba1, Ubc4, conformational change, thioester, adenylation, thioester transfer (transthioesterification), ATP-binding, Rossmann-like Fold, ubiquitin-like fold, Ligase activity, ATP/Mg binding, Ubiquitin E2 binding, ubiquitination, nucleus, LIGASE
Deposited on 2012-12-19, released 2013-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-activating enzyme E1 1
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: ptr3, SPBC1604.21c, SPBC211.09, Ubiquitin activating enzyme 1 (Uba1)
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ubiquitin-60s ribosomal protein l40
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: ubi2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CH07 (7-82)
      • expression tag (3-6)
      • engineered mutation (12)
      • engineered mutation (17)
      • engineered mutation (33-35)
      • engineered mutation (39)
      • engineered mutation (54)
      • engineered mutation (63)
      • engineered mutation (69)
    Domains in SCOPe 2.07: d4ii2b1, d4ii2b2
  • Chain 'C':
    Compound: Ubiquitin-conjugating enzyme E2 4
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: SPBC119.02, ubc4, Ubiquitin conjugating enzyme 4 (Ubc4)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46595 (0-146)
      • engineered mutation (20)
      • engineered mutation (106)
      • expression tag (147-148)
    Domains in SCOPe 2.07: d4ii2c1, d4ii2c2
  • Heterogens: MG, ATP, PG0, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ii2B (B:)
    mhhhhhhmqifvrtltgrtitlevessdtidnvrariqdregippdqqrlifagrqledg
    rtladyniqrestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ii2B (B:)
    hhhhmqifvrtltgrtitlevessdtidnvrariqdregippdqqrlifagrqledgrtl
    adyniqrestlhlvlrlrgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ii2C (C:)
    malkrinreladlgkdppssssagpvgddlfhwqatimgpadspyaggvfflsihfptdy
    pfkppkvnfttriyhpninsngsicldilrdqwspaltiskvllsisslltdpnpddplv
    peiahvyktdrsryelsarewtrkyaihggegaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ii2C (C:)
    malkrinreladlgkdppssssagpvgddlfhwqatimgpadspyaggvfflsihfptdy
    pfkppkvnfttriyhpninsngsicldilrdqwspaltiskvllsisslltdpnpddplv
    peiahvyktdrsryelsarewtrkyaihg