PDB entry 4igu

View 4igu on RCSB PDB site
Description: Crystal structure of the RGS domain of CG5036
Class: signaling protein
Keywords: regulator of g-protein signaling, gtpase-activating proteins (gap), regulator of gz-selective protein signaling 2, signaling protein
Deposited on 2012-12-18, released 2013-12-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-12-18, with a file datestamp of 2013-12-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.186
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cg5036
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG5036, Dmel_CG5036, EG:52C10.2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T017 (12-139)
      • expression tag (11)
      • expression tag (140-147)
    Domains in SCOPe 2.04: d4igua_
  • Chain 'B':
    Compound: cg5036
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG5036, Dmel_CG5036, EG:52C10.2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T017 (12-139)
      • expression tag (11)
      • expression tag (140-147)
    Domains in SCOPe 2.04: d4igub_
  • Heterogens: CL, NA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iguA (A:)
    mrgshhhhhhgsqptleeirswgksfdklmkstagrkvfqnflrsefseenilfwlaced
    lkkenspelveekarliyedyisilsprevsldsrvreivnrnmieptthtfdeaqiqiy
    tlmhrdsyprflnsqkfktlsrpaakln
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iguA (A:)
    sqptleeirswgksfdklmkstagrkvfqnflrsefseenilfwlacedlkkenspelve
    ekarliyedyisilsprevsldsrvreivnrnmieptthtfdeaqiqiytlmhrdsyprf
    lnsqkfktlsrpaakln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4iguB (B:)
    mrgshhhhhhgsqptleeirswgksfdklmkstagrkvfqnflrsefseenilfwlaced
    lkkenspelveekarliyedyisilsprevsldsrvreivnrnmieptthtfdeaqiqiy
    tlmhrdsyprflnsqkfktlsrpaakln
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iguB (B:)
    sqptleeirswgksfdklmkstagrkvfqnflrsefseenilfwlacedlkkenspelve
    ekarliyedyisilsprevsldsrvreivnrnmieptthtfdeaqiqiytlmhrdsyprf
    lnsqkfktlsrpaakln