PDB entry 4ige

View 4ige on RCSB PDB site
Description: Crystal structure of Plasmodium falciparum FabI complexed with NAD and inhibitor 7-(4-Chloro-2-hydroxyphenoxy)-4-methyl-2H-chromen-2-one
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: Reductase, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2012-12-17, released 2013-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-acyl carrier reductase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PfENR, PFF0730c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4igea_
  • Chain 'B':
    Compound: enoyl-acyl carrier reductase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PfENR, PFF0730c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4igeb_
  • Heterogens: CHJ, NAD, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4igeA (A:)
    mvhhhhhhnedicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkf
    dndmiidkdkkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkyg
    kinmlvhslanakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiislty
    hasqkvvpgygggmssakaalesdtrvlayhlgrnynirintisagplksraatainkln
    ntyenntnqnknrnshdvhnimnnsgekeekknsasqnytfidyaieysekyaplrqkll
    stdigsvasfllsresraitgqtiyvdnglnimflpddiyrnene
    

    Sequence, based on observed residues (ATOM records): (download)
    >4igeA (A:)
    edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkd
    kkmnildmlpfdasfdtandidetknnkrynmlqnytiedvanlihqkygkinmlvhsla
    nakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpgy
    gggmssakaalesdtrvlayhlgrnynirintisagplksraataitfidyaieysekya
    plrqkllstdigsvasfllsresraitgqtiyvdnglnimflpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4igeB (B:)
    mvhhhhhhnedicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkf
    dndmiidkdkkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkyg
    kinmlvhslanakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiislty
    hasqkvvpgygggmssakaalesdtrvlayhlgrnynirintisagplksraatainkln
    ntyenntnqnknrnshdvhnimnnsgekeekknsasqnytfidyaieysekyaplrqkll
    stdigsvasfllsresraitgqtiyvdnglnimflpddiyrnene
    

    Sequence, based on observed residues (ATOM records): (download)
    >4igeB (B:)
    edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkd
    kkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsl
    anakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpg
    ygggmssakaalesdtrvlayhlgrnynirintisagplksraatainktfidyaieyse
    kyaplrqkllstdigsvasfllsresraitgqtiyvdnglnimflpd