PDB entry 4ig8

View 4ig8 on RCSB PDB site
Description: Structural basis for cytosolic double-stranded RNA surveillance by human OAS1
Class: transferase/RNA
Keywords: Nucleotidyl transferase, Innate immune system Double-stranded dsRNA sensor RNA polymerase, Nucleotidyl transferase 2-5A synthetase, RNase L activator, Double-stranded RNA, Cytosol, TRANSFERASE-RNA complex
Deposited on 2012-12-16, released 2013-01-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.231
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2'-5'-oligoadenylate synthase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: OAS1, OIAS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4ig8a1, d4ig8a2
  • Chain 'B':
    Compound: RNA (5'-r(*gp*gp*cp*up*up*up*up*gp*ap*cp*cp*up*up*up*ap*up*gp*c)-3')
  • Chain 'C':
    Compound: RNA (5'-r(*gp*cp*ap*up*ap*ap*ap*gp*gp*up*cp*ap*ap*ap*ap*gp*cp*c)-3')
  • Heterogens: MG, DTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ig8A (A:)
    mmdlrntpaksldkfiedyllpdtcfrmqinhaidiicgflkercfrgssypvcvskvvk
    ggssgkgttlrgrsdadlvvflsplttfqdqlnrrgefiqeirrqleacqrerafsvkfe
    vqaprwgnpralsfvlsslqlgegvefdvlpafdalgqltggykpnpqiyvklieectdl
    qkegefstcftelqrdflkqrptklkslirlvkhwyqnckkklgklppqyalelltvyaw
    ergsmkthfntaqgfrtvlelvinyqqlciywtkyydfknpiiekylrrqltkprpvild
    padptgnlgggdpkgwrqlaqeaeawlnypcfknwdgspvsswillagp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ig8A (A:)
    dlrntpaksldkfiedyllpdtcfrmqinhaidiicgflkercfrgssypvcvskvvkgg
    ssgkgttlrgrsdadlvvflsplttfqdqlnrrgefiqeirrqleacqrerafsvkfegn
    pralsfvlsslqlgegvefdvlpafdalgqltggykpnpqiyvklieectdlqkegefst
    cftelqrdflkqrptklkslirlvkhwyqnckkklgklppqyalelltvyawergsmkth
    fntaqgfrtvlelvinyqqlciywtkyydfknpiiekylrrqltkprpvildpadptgnl
    gggdpkgwrqlaqeaeawlnypcfknwdgspvsswill
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.