PDB entry 4ift

View 4ift on RCSB PDB site
Description: Crystal structure of double mutant thermostable NPPase from Geobacillus stearothermophilus
Class: hydrolase
Keywords: thermostable NPPase, HYDROLASE
Deposited on 2012-12-15, released 2013-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermostable NPPase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8L1N9 (12-266)
      • engineered mutation (161)
      • engineered mutation (168)
    Domains in SCOPe 2.07: d4ifta_
  • Chain 'B':
    Compound: Thermostable NPPase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8L1N9 (12-266)
      • engineered mutation (161)
      • engineered mutation (168)
    Domains in SCOPe 2.07: d4iftb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iftA (A:)
    mrgshhhhhhgsmrkyngylidldgtmyrgteridaasgfikelnrlhipylfvtnnstr
    tpeqvadklvsldipatpeqiftssmatanyvydldqnamiyfigeeglykalkekgfsf
    adenadvvivgldrevtyeklavaclavrngaklistngdlvlpterglmpgngaftali
    shstqvkatfvgkpepiimeqalkvlgtnknetimvgdnydtdilagiragldtllvhtg
    vttveklkeykqqptysmkslddwkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iftA (A:)
    mrkyngylidldgtmyrgteridaasgfikelnrlhipylfvtnnstrtpeqvadklvsl
    dipatpeqiftssmatanyvydldqnamiyfigeeglykalkekgfsfadenadvvivgl
    drevtyeklavaclavrngaklistngdlvlpterglmpgngaftalishstqvkatfvg
    kpepiimeqalkvlgtnknetimvgdnydtdilagiragldtllvhtgvttveklkeykq
    qptysmkslddwkfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4iftB (B:)
    mrgshhhhhhgsmrkyngylidldgtmyrgteridaasgfikelnrlhipylfvtnnstr
    tpeqvadklvsldipatpeqiftssmatanyvydldqnamiyfigeeglykalkekgfsf
    adenadvvivgldrevtyeklavaclavrngaklistngdlvlpterglmpgngaftali
    shstqvkatfvgkpepiimeqalkvlgtnknetimvgdnydtdilagiragldtllvhtg
    vttveklkeykqqptysmkslddwkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iftB (B:)
    mrkyngylidldgtmyridaasgfikelnrlhipylfvtnnstrtpeqvadklvsldipa
    tpeqiftssmatanyvydldqnamiyfigeeglykalkekgfsfadenadvvivgldrev
    tyeklavaclavrngaklistngdlvlpterglmpgngaftalishstqvkatfvgkpep
    iimeqalkvlgtnknetimvgdnydtdilagiragldtllvhtgvttveykqqptysmks
    lddwkfl