PDB entry 4ifr

View 4ifr on RCSB PDB site
Description: 2.40 Angstroms X-ray crystal structure of R239A 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase from Pseudomonas fluorescens
Class: lyase
Keywords: TIM-BARREL, Decarboxylase, Metal-binding, LYASE
Deposited on 2012-12-14, released 2013-09-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.214
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83V25 (0-329)
      • engineered mutation (235)
    Domains in SCOPe 2.04: d4ifra_
  • Chain 'B':
    Compound: 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83V25 (0-329)
      • engineered mutation (235)
    Domains in SCOPe 2.04: d4ifrb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ifrA (A:)
    pridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfrpvyqalwdpafr
    ieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaqvpl
    qdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwdmmg
    gqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfghgggsfafllgavdna
    wrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplgeqk
    igglvlssnlgesakdkiisgnaskffnin
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ifrB (B:)
    pridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfrpvyqalwdpafr
    ieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaqvpl
    qdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwdmmg
    gqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfghgggsfafllgavdna
    wrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplgeqk
    igglvlssnlgesakdkiisgnaskffnin