PDB entry 4ifk

View 4ifk on RCSB PDB site
Description: Arginines 51 and 239* from a Neighboring Subunit are Essential for Catalysis in a Zinc-dependent Decarboxylase
Class: lyase
Keywords: TIM-BARREL, Decarboxylation, Metal-binding, LYASE
Deposited on 2012-12-14, released 2013-09-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.211
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83V25 (0-330)
      • engineered mutation (236)
    Domains in SCOPe 2.05: d4ifka_
  • Chain 'B':
    Compound: 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83V25 (0-330)
      • engineered mutation (48)
    Domains in SCOPe 2.05: d4ifkb_
  • Heterogens: MG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ifkA (A:)
    kpridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfrpvyqalwdpaf
    rieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaqvp
    lqdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwdmm
    ggqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfghgggsfafllgavdn
    awrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplgeq
    kigglvlssnlgesakdkiisgnaskffnin
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ifkB (B:)
    kpridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfapvyqalwdpaf
    rieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaqvp
    lqdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwdmm
    ggqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfghgggsfafllgrvdn
    awrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplgeq
    kigglvlssnlgesakdkiisgnaskffnin