PDB entry 4ifj

View 4ifj on RCSB PDB site
Description: Crystal Structures of apo Keap1, Keap1-peptide, and Keap1-compound complexes
Class: transcription
Keywords: protein binding, transcription
Deposited on 2012-12-14, released 2014-08-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-08-20, with a file datestamp of 2014-08-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kelch-like ECH-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KEAP1, INRF2, KIAA0132, KLHL19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ifja_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ifjA (A:)
    ssapkvgrliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavg
    grnnspdgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhn
    sveryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewr
    mitamntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalg
    itvhqgriyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ifjA (A:)
    pkvgrliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrn
    nspdgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsve
    ryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmit
    amntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgitv
    hqgriyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt