PDB entry 4iff

View 4iff on RCSB PDB site
Description: Structural organization of FtsB, a transmembrane protein of the bacterial divisome
Class: cell cycle
Keywords: bacterial division, FtsL, CELL CYCLE
Deposited on 2012-12-14, released 2013-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fusion of phage phi29 Gp7 protein and Cell division protein FtsB
    Species: Escherichia coli [TaxId:562]
    Gene: 7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13848 (3-49)
      • expression tag (2)
    • Uniprot P0A6S5 (50-End)
    Domains in SCOPe 2.07: d4iffa1, d4iffa2
  • Chain 'B':
    Compound: Fusion of phage phi29 Gp7 protein and Cell division protein FtsB
    Species: Escherichia coli [TaxId:562]
    Gene: 7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13848 (3-49)
      • expression tag (2)
    • Uniprot P0A6S5 (50-End)
    Domains in SCOPe 2.07: d4iffb1, d4iffb2
  • Chain 'C':
    Compound: Fusion of phage phi29 Gp7 protein and Cell division protein FtsB
    Species: Escherichia coli [TaxId:562]
    Gene: 7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13848 (3-49)
      • expression tag (2)
    • Uniprot P0A6S5 (50-End)
    Domains in SCOPe 2.07: d4iffc1, d4iffc2
  • Chain 'D':
    Compound: Fusion of phage phi29 Gp7 protein and Cell division protein FtsB
    Species: Escherichia coli [TaxId:562]
    Gene: 7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13848 (3-49)
      • expression tag (2)
    • Uniprot P0A6S5 (50-End)
    Domains in SCOPe 2.07: d4iffd1, d4iffd2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iffA (A:)
    gsgplkpeehedilnklldpelaqsertealqqlrvnygsfvseyndltkdytrvnddva
    aqqatnaklkarndqlfaeiddlngg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iffA (A:)
    gplkpeehedilnklldpelaqsertealqqlrvnygsfvseyndltkdytrvnddvaaq
    qatnaklkarndqlfaeiddl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4iffB (B:)
    gsgplkpeehedilnklldpelaqsertealqqlrvnygsfvseyndltkdytrvnddva
    aqqatnaklkarndqlfaeiddlngg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iffB (B:)
    gplkpeehedilnklldpelaqsertealqqlrvnygsfvseyndltkdytrvnddvaaq
    qatnaklkarndqlfaeiddl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4iffC (C:)
    gsgplkpeehedilnklldpelaqsertealqqlrvnygsfvseyndltkdytrvnddva
    aqqatnaklkarndqlfaeiddlngg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iffC (C:)
    gplkpeehedilnklldpelaqsertealqqlrvnygsfvseyndltkdytrvnddvaaq
    qatnaklkarndqlfaeiddln
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4iffD (D:)
    gsgplkpeehedilnklldpelaqsertealqqlrvnygsfvseyndltkdytrvnddva
    aqqatnaklkarndqlfaeiddlngg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iffD (D:)
    gplkpeehedilnklldpelaqsertealqqlrvnygsfvseyndltkdytrvnddvaaq
    qatnaklkarndqlfaeiddl