PDB entry 4iew

View 4iew on RCSB PDB site
Description: Cys-only bound Cysteine Dioxygenase at pH 9.0 in the presence of Cys
Class: oxidoreductase
Keywords: Cupin fold, catalyzes oxidation, cysteine to cysteine sulfinate, C93-Y157 crosslink, Cytosol, OXIDOREDUCTASE
Deposited on 2012-12-13, released 2013-06-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-09-11, with a file datestamp of 2013-09-06.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.154
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine dioxygenase type 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Cdo1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4iewa_
  • Heterogens: FE2, CYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iewA (A:)
    mertellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytr
    nlvdqgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikk
    sertlrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmt
    fhskfgirtpfttsgslenn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iewA (A:)
    ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
    qgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksert
    lrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhsk
    fgirtp