PDB entry 4ieh

View 4ieh on RCSB PDB site
Description: Crystal Structure of human Bcl-2 in complex with a small molecule inhibitor targeting Bcl-2 BH3 domain interactions
Class: apoptosis/inhibitor
Keywords: protein-protein interaction, alpha helical, pro-apoptosis, cytochrome c release, caspase activation, BIM, BAK, BAD, PUMA, APOPTOSIS-INHIBITOR complex
Deposited on 2012-12-13, released 2013-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apoptosis regulator Bcl-2, Bcl-2-like protein 1 chimera
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL2, BCL2L, BCL2L1, BCLX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4ieha_
  • Heterogens: 1E9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4iehA (A:)
gshmahagrtgydnreivmkyihyklsqrgyewdagddveenrteapegtesevvhltlr
qagddfsrryrrdfaemssqlhltpftargrfatvveelfrdgvnwgrivaffefggvmc
vesvnremsplvdnialwmteylnrhlhtwiqdnggwdafvelygpsmr

    Sequence, based on observed residues (ATOM records): (download) 
    >4iehA (A:)
ydnreivmkyihyklsqrgyewdsevvhltlrqagddfsrryrrdfaemssqlhltpfta
rgrfatvveelfrdgvnwgrivaffefggvmcvesvnremsplvdnialwmteylnrhlh
twiqdnggwdafvelygp