PDB entry 4ie3

View 4ie3 on RCSB PDB site
Description: Crystal structure of human Arginase-2 complexed with inhbitor 1o
Class: Hydrolase/Hydrolase inhibitor
Keywords: metalloenzyme, alpha/beta fold, Hydrolase, Arginine metabolism, Manganese, Mitochondrion, Hydrolase-Hydrolase inhibitor complex
Deposited on 2012-12-13, released 2013-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginase-2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ARG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ie3a_
  • Chain 'B':
    Compound: Arginase-2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ARG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ie3b_
  • Chain 'C':
    Compound: Arginase-2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ARG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ie3c_
  • Heterogens: MN, BEN, BME, 1EE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ie3A (A:)
    hsvavigapfsqgqkrkgvehgpaaireaglmkrlsslgchlkdfgdlsftpvpkddlyn
    nlivnprsvglanqelaevvsravsdgyscvtlggdhslaigtisgharhcpdlcvvwvd
    ahadintplttssgnlhgqpvsfllrelqdkvpqlpgfswikpcissasivyiglrdvdp
    pehfilknydiqyfsmrdidrlgiqkvmertfdlligkrqrpihlsfdidafdptlapat
    gtpvvggltyregmyiaeeihntgllsaldlvevnpqlatseeeakttanlavdviassf
    gqtreg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ie3B (B:)
    hsvavigapfsqgqkrkgvehgpaaireaglmkrlsslgchlkdfgdlsftpvpkddlyn
    nlivnprsvglanqelaevvsravsdgyscvtlggdhslaigtisgharhcpdlcvvwvd
    ahadintplttssgnlhgqpvsfllrelqdkvpqlpgfswikpcissasivyiglrdvdp
    pehfilknydiqyfsmrdidrlgiqkvmertfdlligkrqrpihlsfdidafdptlapat
    gtpvvggltyregmyiaeeihntgllsaldlvevnpqlatseeeakttanlavdviassf
    gqtreg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ie3C (C:)
    hsvavigapfsqgqkrkgvehgpaaireaglmkrlsslgchlkdfgdlsftpvpkddlyn
    nlivnprsvglanqelaevvsravsdgyscvtlggdhslaigtisgharhcpdlcvvwvd
    ahadintplttssgnlhgqpvsfllrelqdkvpqlpgfswikpcissasivyiglrdvdp
    pehfilknydiqyfsmrdidrlgiqkvmertfdlligkrqrpihlsfdidafdptlapat
    gtpvvggltyregmyiaeeihntgllsaldlvevnpqlatseeeakttanlavdviassf
    gqtreg