PDB entry 4id8

View 4id8 on RCSB PDB site
Description: The crystal structure of a [3Fe-4S] ferredoxin associated with CYP194A4 from R. palustris HaA2
Class: electron transport
Keywords: 4Fe-4S single cluster domain, ELECTRON TRANSPORT
Deposited on 2012-12-11, released 2013-12-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.196
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative ferredoxin
    Species: Rhodopseudomonas palustris [TaxId:316058]
    Gene: RPB_3630
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4id8a_
  • Heterogens: F3S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4id8A (A:)
msemltihvdqdkcqgharckalapelfdlddygnahekgdgvvpadlidkawlaksncp
enaidited

    Sequence, based on observed residues (ATOM records): (download) 
    >4id8A (A:)
ltihvdqdkcqgharckalapelfdlddygnahekgdgvvpadlidkawlaksncpenai
dited