PDB entry 4id6

View 4id6 on RCSB PDB site
Description: Crystal Structure of Staphylococcal nuclease mutant V23I/I72L
Class: Hydrolase
Keywords: Hydrolase
Deposited on 2012-12-11, released 2013-03-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.19
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (22)
      • engineered mutation (71)
    Domains in SCOPe 2.06: d4id6a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4id6A (A:)
    atstkklhkepatlikaidgdtiklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
    ftkkmvenakklevefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
    heqhlrkseaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4id6A (A:)
    klhkepatlikaidgdtiklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
    venakklevefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhl
    rkseaqakkeklniws