PDB entry 4icu

View 4icu on RCSB PDB site
Description: Ubiquitin-like domain of human tubulin folding cofactor E - crystal from A
Class: chaperone
Keywords: Ubiquitin-like domain, tubulin folding cofactor, alpha tubulin, tubulin folding cofactor B, CHAPERONE
Deposited on 2012-12-11, released 2014-06-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-22, with a file datestamp of 2016-06-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tubulin-specific chaperone E
    Species: Homo sapiens [TaxId:9606]
    Gene: TBCE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4icua_
  • Chain 'B':
    Compound: Tubulin-specific chaperone E
    Species: Homo sapiens [TaxId:9606]
    Gene: TBCE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4icub_
  • Chain 'C':
    Compound: Tubulin-specific chaperone E
    Species: Homo sapiens [TaxId:9606]
    Gene: TBCE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4icuc_
  • Chain 'D':
    Compound: Tubulin-specific chaperone E
    Species: Homo sapiens [TaxId:9606]
    Gene: TBCE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4icud_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4icuA (A:)
    nqlltlkikyphqldqkvlekqlpgsmtiqkvkgllsrllkvpvsdlllsyespkkpgre
    ielendlkslqfysvengdcllvrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4icuA (A:)
    qlltlkikyphqldqkvlekqlpgsmtiqkvkgllsrllkvpvsdlllsyespkkpgrei
    elendlkslqfysvengdcllvrw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4icuB (B:)
    nqlltlkikyphqldqkvlekqlpgsmtiqkvkgllsrllkvpvsdlllsyespkkpgre
    ielendlkslqfysvengdcllvrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4icuB (B:)
    qlltlkikyphqldqkvlekqlpgsmtiqkvkgllsrllkvpvsdlllsyespkkpgrei
    elendlkslqfysvengdcllvrw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4icuC (C:)
    nqlltlkikyphqldqkvlekqlpgsmtiqkvkgllsrllkvpvsdlllsyespkkpgre
    ielendlkslqfysvengdcllvrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4icuC (C:)
    qlltlkikyphqldqkvlekqlpgsmtiqkvkgllsrllkvpvsdlllsyespkkpgrei
    elendlkslqfysvengdcllvrw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4icuD (D:)
    nqlltlkikyphqldqkvlekqlpgsmtiqkvkgllsrllkvpvsdlllsyespkkpgre
    ielendlkslqfysvengdcllvrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4icuD (D:)
    qlltlkikyphqldqkvlekqlpgsmtiqkvkgllsrllkvpvsdlllsyespkkpgrei
    elendlkslqfysvengdcllvrw