PDB entry 4ict

View 4ict on RCSB PDB site
Description: Substrate and reaction specificity of Mycobacterium tuberculosis cytochrome P450 CYP121
Class: oxidoreductase
Keywords: Protein-ligand complex, OXIDOREDUCTASE
Deposited on 2012-12-11, released 2013-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 121
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: cyp121, Rv2276, MT2336, MTCY339.34c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4icta_
  • Heterogens: SO4, HEM, 1ED, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ictA (A:)
    atvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfsm
    ketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtanslld
    nlitegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakinw
    drdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsfl
    ttalisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrkg
    elvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigieal
    lkkmpgvdlavpidqlvwrtrfqrriperlpvlw