PDB entry 4icd

View 4icd on RCSB PDB site
Description: regulation of isocitrate dehydrogenase by phosphorylation involves no long-range conformational change in the free enzyme
Class: oxidoreductase (nad(a)-choh(d))
Keywords: oxidoreductase (nad(a)-choh(d))
Deposited on 1989-12-28, released 1991-01-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.169
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphorylated isocitrate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4icda_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4icdA (A:)
    meskvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykge
    rkiswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrq
    eldlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflr
    eemgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftega
    fkdwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydvia
    cmnlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsa
    emmlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4icdA (A:)
    skvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykgerk
    iswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrqel
    dlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflree
    mgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegafk
    dwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviacm
    nlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsaem
    mlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm