PDB entry 4icc

View 4icc on RCSB PDB site
Description: Crystal structure of human AKR1B10 complexed with NADP+ and JF0064
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: TIM barrel, Aldo-Keto Reductase, Oxidoreductase, Halogenated compound, cytosolic, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2012-12-10, released 2014-02-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.163
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Aldo-keto reductase family 1 member B10
    Species: Homo sapiens [TaxId:9606]
    Gene: AKR1B10, AKR1B11
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60218 (0-315)
      • engineered mutation (124)
      • engineered mutation (300)
    Domains in SCOPe 2.06: d4iccx_
  • Heterogens: NAP, 64I, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4iccX (X:)
    matfvelstkakmpivglgtwksplgkvkeavkvaidagyrhidcayvyqnehevgeaiq
    ekiqekavkredlfivsklwptfferplvrkafektlkdlklsyldvylihwpqgfksgd
    dlfprddkgnaiggkatfldaweameelvdeglvkalgvsnfshfqiekllnkpglkykp
    vtnqvechpyltqekliqychskgitvtaysplgspdrpwakpedpslledpkikeiaak
    hkktaaqvlirfhiqrnvivipksvtpariveniqvfdfklsdeematilsfnrnwracn
    llqsshledypfnaey