PDB entry 4icb

View 4icb on RCSB PDB site
Description: proline cis-trans isomers in calbindin d9k observed by x-ray crystallography
Deposited on 1991-08-27, released 1993-10-31
The last revision prior to the SCOP 1.61 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.6 Å
R-factor: 0.188
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d4icb__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4icb_ (-)
  mkspeelkgifekyaakegdpnqlskeelklllqtefpsllkgpstldelfeeldkngdg
  evsfeefqvlvkkisq