PDB entry 4ic8

View 4ic8 on RCSB PDB site
Description: Crystal structure of the apo ERK5 kinase domain
Class: transferase
Keywords: kinase, signaling, transferase
Deposited on 2012-12-10, released 2013-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.263
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 7
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK7, BMK1, ERK5, PRKM7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4ic8a_
  • Chain 'B':
    Compound: Mitogen-activated protein kinase 7
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK7, BMK1, ERK5, PRKM7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4ic8b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ic8A (A:)
    gsmaeplkeedgedgsaeppgpvkaepahtaasvaaknlallkarsfdvtfdvgdeyeii
    etigngaygvvssarrrltgqqvaikkipnafdvvtnakrtlrelkilkhfkhdniiaik
    dilrptvpygefksvyvvldlmesdlhqiihssqpltlehvryflyqllrglkymhsaqv
    ihrdlkpsnllvnencelkigdfgmarglctspaehqyfmteyvatrwyrapelmlslhe
    ytqaidlwsvgcifgemlarrqlfpgknyvhqlqlimmvlgtpspaviqavgaervrayi
    qslpprqpvpwetvypgadrqalsllgrmlrfepsarisaaaalrhpflakyhdpddepd
    cappfdfafdrealtrerikeaivaeiedfharregirqqirfqpslqpvasepgcpdve
    mpspwapsgdcamsgrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ic8A (A:)
    lkarsfdvtfdvgdeyeiietigvvssarrrltgqqvaikkipnafdvvtnakrtlrelk
    ilkhfkhdniiaikdilrptvpygefksvyvvldlmesdlhqiihstlehvryflyqllr
    glkymhsaqvihrdlkpsnllvnencelkigdfgmteyvatrwyrapelmlslheytqai
    dlwsvgcifgemlarrqlfpgknyvhqlqlimmvlgtpspaviqavgaervrayiqslpp
    rqpvpwetvypgadrqalsllgrmlrfepsarisaaaalrhpflakyhdpddepdcappf
    dfafdaltrerikeaivaeiedfha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ic8B (B:)
    gsmaeplkeedgedgsaeppgpvkaepahtaasvaaknlallkarsfdvtfdvgdeyeii
    etigngaygvvssarrrltgqqvaikkipnafdvvtnakrtlrelkilkhfkhdniiaik
    dilrptvpygefksvyvvldlmesdlhqiihssqpltlehvryflyqllrglkymhsaqv
    ihrdlkpsnllvnencelkigdfgmarglctspaehqyfmteyvatrwyrapelmlslhe
    ytqaidlwsvgcifgemlarrqlfpgknyvhqlqlimmvlgtpspaviqavgaervrayi
    qslpprqpvpwetvypgadrqalsllgrmlrfepsarisaaaalrhpflakyhdpddepd
    cappfdfafdrealtrerikeaivaeiedfharregirqqirfqpslqpvasepgcpdve
    mpspwapsgdcamsgrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ic8B (B:)
    lkarsfdvtfdvgdeyeiietigngaygvvssarrrltgqqvaikkipnafdvvtnakrt
    lrelkilkhfkhdniiaikdilrptvpygefksvyvvldlmesdlhqiihssqpltlehv
    ryflyqllrglkymhsaqvihrdlkpsnllvnencelkigdfgmteyvatrwyrapelml
    slheytqaidlwsvgcifgemlarrqlfpgknyvhqlqlimmvlgtpspaviqavgaerv
    rayiqslpprqpvpwetvypgadrqalsllgrmlrfepsarisaaaalrhpflakyhdpd
    depdcappfdfafdrealtrerikeaivaeiedfha