PDB entry 4ic5

View 4ic5 on RCSB PDB site
Description: Crystal structure of Deg5
Class: hydrolase
Keywords: Bets-barrel, endopeptidase, Calcium Binding, chloroplast, HYDROLASE
Deposited on 2012-12-10, released 2013-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.184
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease Do-like 5, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: DEGP5, HHOA, At4g18370, F28J12.30
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SEL7
      • engineered mutation (216)
    Domains in SCOPe 2.07: d4ic5a_
  • Chain 'B':
    Compound: Protease Do-like 5, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: DEGP5, HHOA, At4g18370, F28J12.30
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SEL7
      • engineered mutation (216)
    Domains in SCOPe 2.07: d4ic5b_
  • Chain 'C':
    Compound: Protease Do-like 5, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: DEGP5, HHOA, At4g18370, F28J12.30
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SEL7
      • engineered mutation (216)
    Domains in SCOPe 2.07: d4ic5c_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ic5A (A:)
    mgsshhhhhhssglvprgshmasaleqfkekeeeleeeeernvnlfqktspsvvyieaie
    lpktssgdiltdeengkiegtgsgfvwdklghivtnyhviaklatdqfglqrckvslvda
    kgtrfskegkivgldpdndlavlkietegrelnpvvlgtsndlrvgqscfaignpygyen
    tltigvvsglgreipspngksiseaiqtdadinsgnaggplldsyghtigvntatftrkg
    sgmssgvnfaipidtvvrtvpylivygtayrdrlssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ic5A (A:)
    eeleeeeernvnlfqktspsvvyieaielegtgsgfvwdklghivtnyhviaklatdqfg
    lqrckvslvdakgtrfskegkivgldpdndlavlkietegrelnpvvlgtsndlrvgqsc
    faignpygyentltigvvsglgreipspngksiseaiqtdadinsgnaggplldsyghti
    gvntatfvnfaipidtvvrtvpylivygta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ic5B (B:)
    mgsshhhhhhssglvprgshmasaleqfkekeeeleeeeernvnlfqktspsvvyieaie
    lpktssgdiltdeengkiegtgsgfvwdklghivtnyhviaklatdqfglqrckvslvda
    kgtrfskegkivgldpdndlavlkietegrelnpvvlgtsndlrvgqscfaignpygyen
    tltigvvsglgreipspngksiseaiqtdadinsgnaggplldsyghtigvntatftrkg
    sgmssgvnfaipidtvvrtvpylivygtayrdrlssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ic5B (B:)
    eeleeeeernvnlfqktspsvvyieaielegtgsgfvwdklghivtnyhviaklatdqfg
    lqrckvslvdakgtrfskegkivgldpdndlavlkietegrelnpvvlgtsndlrvgqsc
    faignpygyentltigvvsglgreipspngksiseaiqtdadinsgnaggplldsyghti
    gvntatfvnfaipidtvvrtvpylivygta
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ic5C (C:)
    mgsshhhhhhssglvprgshmasaleqfkekeeeleeeeernvnlfqktspsvvyieaie
    lpktssgdiltdeengkiegtgsgfvwdklghivtnyhviaklatdqfglqrckvslvda
    kgtrfskegkivgldpdndlavlkietegrelnpvvlgtsndlrvgqscfaignpygyen
    tltigvvsglgreipspngksiseaiqtdadinsgnaggplldsyghtigvntatftrkg
    sgmssgvnfaipidtvvrtvpylivygtayrdrlssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ic5C (C:)
    eeleeeeernvnlfqktspsvvyieaielgtgsgfvwdklghivtnyhviaklatdqfgl
    qrckvslvdakgtrfskegkivgldpdndlavlkietegrelnpvvlgtsndlrvgqscf
    aignpygyentltigvvsglgreipspngksiseaiqtdadinsgnaggplldsyghtig
    vntatfvnfaipidtvvrtvpylivygta