PDB entry 4ibm

View 4ibm on RCSB PDB site
Description: Crystal structure of insulin receptor kinase domain in complex with an inhibitor Irfin-1
Class: transferase/transferase inhibitor
Keywords: irk, kinase, ATP binding, Phosphorylation, Membrane, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-12-08, released 2013-08-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Insulin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: INSR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06213
      • engineered mutation (273)
    Domains in SCOPe 2.06: d4ibma_
  • Chain 'B':
    Compound: Insulin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: INSR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06213 (Start-305)
      • engineered mutation (273)
    Domains in SCOPe 2.06: d4ibmb_
  • Heterogens: IR1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ibmA (A:)
    vfpcsvyvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesas
    lrerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaen
    npgrppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdi
    yetdyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneq
    vlkfvmdggyldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsff
    hseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ibmA (A:)
    svyvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslrer
    ieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgr
    ppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetd
    yyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkf
    vmdggyldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhsee
    n
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ibmB (B:)
    vfpcsvyvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesas
    lrerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaen
    npgrppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdi
    yetdyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneq
    vlkfvmdggyldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsff
    hseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ibmB (B:)
    dewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslreriefln
    easvmkgftchhvvrllgvvsptlvvmelmahgdlksylrslrpeaennpgrppptlqem
    iqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkggkg
    llpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdggyld
    qpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk