PDB entry 4ib6

View 4ib6 on RCSB PDB site
Description: Bovine beta-lactoglobulin (isoform A) in complex with lauric acid (C12)
Class: transport protein
Keywords: lipocalin, transport protein
Deposited on 2012-12-08, released 2013-06-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-07-17, with a file datestamp of 2013-07-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.219
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactoglobulin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02754 (0-161)
      • viriant (63)
      • viriant (117)
    Domains in SCOPe 2.03: d4ib6a_
  • Heterogens: DAO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ib6A (A:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ib6A (A:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensqslvcqclvr
    tpevddealekfdkalkalpmhirlsfnptqleeqchi