PDB entry 4iau

View 4iau on RCSB PDB site
Description: Atomic resolution structure of Geodin, a beta-gamma crystallin from Geodia cydonium
Class: unknown function
Keywords: Greek key strand motif, UNKNOWN FUNCTION
Deposited on 2012-12-07, released 2013-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 0.99 Å
R-factor: 0.107
AEROSPACI score: 1.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-gamma-crystallin
    Species: Geodia cydonium [TaxId:6047]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4iaua_
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iauA (A:)
    mstakvtlvtsggssqdftseqtnittdfarvrvtkgmwifyqqanyndasgggslwikl
    desshlmdlpftprsfrpvktfqvgatlykhvnfggkeldlpnsnpridiggvssalisq
    gqwrlyeqydyagpstrrgpgvyvnagalgvandalksmeref
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iauA (A:)
    stakvtlvtsggssqdftseqtnittdfarvrvtkgmwifyqqanyndasgggslwikld
    esshlmdlpftprsfrpvktfqvgatlykhvnfggkeldlpnsnpridiggvssalisqg
    qwrlyeqydyagpstrrgpgvyvnagalgvandalksmere