PDB entry 4i9s

View 4i9s on RCSB PDB site
Description: Crystal Structure of the R111K:R132L:Y134F:T54V:R59W Mutant of the Cellular Retinoic Acid Binding Protein Type II in Complex with All-Trans Retinal at 2.58 Angstrom Resolution
Class: transport protein
Keywords: protein engineering, wavelength regulation, pH sensing, pKa, retinylidene PSB, iminium, TRANSPORT PROTEIN
Deposited on 2012-12-05, released 2013-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: 0.227
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular retinoic acid-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CRABP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29373 (0-136)
      • engineered mutation (53)
      • engineered mutation (58)
      • engineered mutation (110)
      • engineered mutation (131)
      • engineered mutation (133)
    Domains in SCOPe 2.08: d4i9sa_
  • Heterogens: RET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4i9sA (A:)
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyikvsttvwt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtkeltndgeli
ltmtaddvvctlvfvre