PDB entry 4i8h

View 4i8h on RCSB PDB site
Description: Bovine trypsin at 0.75 resolution
Class: hydrolase
Keywords: Serine protease, HYDROLASE
Deposited on 2012-12-03, released 2012-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 0.75 Å
R-factor: 0.102
AEROSPACI score: 1.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4i8ha_
  • Heterogens: CA, BEN, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4i8hA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn