PDB entry 4i89

View 4i89 on RCSB PDB site
Description: Crystal structure of transthyretin in complex with diflunisal at acidic pH
Class: transport protein/inhibitor
Keywords: amyloidosis, fibrillogenesis inhibitor, transthyretin stabilizers, T4 or T3 hormone, plasma, transport protein-inhibitor complex
Deposited on 2012-12-03, released 2013-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.192
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, TTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (83)
    Domains in SCOPe 2.07: d4i89a_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, TTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (83)
    Domains in SCOPe 2.07: d4i89b_
  • Heterogens: 1FL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i89A (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgsspfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i89A (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgsspfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4i89B (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgsspfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i89B (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgsspfhehaevvftandsgprrytiaallspysysttavvtn