PDB entry 4i83

View 4i83 on RCSB PDB site
Description: Crystal Structure of (3R)-Hydroxymyristoyl-ACP Dehydratase from Neisseria meningitidis FAM18
Class: lyase
Keywords: FabZ, Hot Dog Fold, thioesterase, LYASE
Deposited on 2012-12-02, released 2013-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
    Species: Neisseria meningitidis [TaxId:272831]
    Gene: fabZ, NMC0170
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i83a_
  • Chain 'B':
    Compound: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
    Species: Neisseria meningitidis [TaxId:272831]
    Gene: fabZ, NMC0170
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i83b_
  • Chain 'C':
    Compound: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
    Species: Neisseria meningitidis [TaxId:272831]
    Gene: fabZ, NMC0170
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i83c_
  • Chain 'D':
    Compound: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
    Species: Neisseria meningitidis [TaxId:272831]
    Gene: fabZ, NMC0170
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i83d_
  • Chain 'E':
    Compound: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
    Species: Neisseria meningitidis [TaxId:272831]
    Gene: fabZ, NMC0170
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i83e_
  • Chain 'F':
    Compound: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
    Species: Neisseria meningitidis [TaxId:272831]
    Gene: fabZ, NMC0170
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i83f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i83A (A:)
    snamdvqlpieakdiqkliphrypflqldritafepmktltaiknvsinepqfqghfpdl
    pvmpgvliieamaqacgtlailseggrkeneffffagidearfkrqvipgdqlvfevell
    tsrrgigkfnavakvdgqvaveaiimcakrvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i83A (A:)
    vqlpieakdiqkliphrypflqldritafepmktltaiknvsinepqfqghfpdlpvmpg
    vliieamaqacgtlailseggrkeneffffagidearfkrqvipgdqlvfevelltsrrg
    igkfnavakvdgqvaveaiimcak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4i83B (B:)
    snamdvqlpieakdiqkliphrypflqldritafepmktltaiknvsinepqfqghfpdl
    pvmpgvliieamaqacgtlailseggrkeneffffagidearfkrqvipgdqlvfevell
    tsrrgigkfnavakvdgqvaveaiimcakrvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i83B (B:)
    vqlpieakdiqkliphrypflqldritafepmktltaiknvsinepqfqghfpdlpvmpg
    vliieamaqacgtlailseggrkeneffffagidearfkrqvipgdqlvfevelltsrrg
    igkfnavakvdgqvaveaiimcak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4i83C (C:)
    snamdvqlpieakdiqkliphrypflqldritafepmktltaiknvsinepqfqghfpdl
    pvmpgvliieamaqacgtlailseggrkeneffffagidearfkrqvipgdqlvfevell
    tsrrgigkfnavakvdgqvaveaiimcakrvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i83C (C:)
    vqlpieakdiqkliphrypflqldritafepmktltaiknvsinepqfqghfpdlpvmpg
    vliieamaqacgtlailseggrkeneffffagidearfkrqvipgdqlvfevelltsrrg
    igkfnavakvdgqvaveaiimcak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4i83D (D:)
    snamdvqlpieakdiqkliphrypflqldritafepmktltaiknvsinepqfqghfpdl
    pvmpgvliieamaqacgtlailseggrkeneffffagidearfkrqvipgdqlvfevell
    tsrrgigkfnavakvdgqvaveaiimcakrvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i83D (D:)
    vqlpieakdiqkliphrypflqldritafepmktltaiknvsinepqfqghfpdlpvmpg
    vliieamaqacgtlailseggrkeneffffagidearfkrqvipgdqlvfevelltsrrg
    igkfnavakvdgqvaveaiimcak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4i83E (E:)
    snamdvqlpieakdiqkliphrypflqldritafepmktltaiknvsinepqfqghfpdl
    pvmpgvliieamaqacgtlailseggrkeneffffagidearfkrqvipgdqlvfevell
    tsrrgigkfnavakvdgqvaveaiimcakrvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i83E (E:)
    vqlpieakdiqkliphrypflqldritafepmktltaiknvsinepqfqghfpdlpvmpg
    vliieamaqacgtlailseggrkeneffffagidearfkrqvipgdqlvfevelltsrrg
    igkfnavakvdgqvaveaiimcak
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4i83F (F:)
    snamdvqlpieakdiqkliphrypflqldritafepmktltaiknvsinepqfqghfpdl
    pvmpgvliieamaqacgtlailseggrkeneffffagidearfkrqvipgdqlvfevell
    tsrrgigkfnavakvdgqvaveaiimcakrvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i83F (F:)
    vqlpieakdiqkliphrypflqldritafepmktltaiknvsinepqfqghfpdlpvmpg
    vliieamaqacgtlailseggrkeneffffagidearfkrqvipgdqlvfevelltsrrg
    igkfnavakvdgqvaveaiimcak