PDB entry 4i78

View 4i78 on RCSB PDB site
Description: Crystal structure of a subtype H17 hemagglutinin homologue from A/little yellow-shouldered bat/Guatemala/060/2010 (H17N10)
Class: viral protein
Keywords: influenza vrus, hemagglutinin homologue, H17, viral protein, ectodomain
Deposited on 2012-11-30, released 2013-01-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 3.18 Å
R-factor: 0.205
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin HA1
    Species: Influenza A virus [TaxId:1129347]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4i78a_
  • Chain 'B':
    Compound: hemagglutinin HA1
    Species: Influenza A virus [TaxId:1129347]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4i78b_
  • Chain 'C':
    Compound: hemagglutinin HA2
    Species: Influenza A virus [TaxId:1129347]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot H6QM93 (Start-173)
      • engineered mutation (46)
      • expression tag (174)
    Domains in SCOPe 2.06: d4i78c1, d4i78c2
  • Chain 'D':
    Compound: hemagglutinin HA2
    Species: Influenza A virus [TaxId:1129347]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot H6QM93 (Start-173)
      • engineered mutation (46)
      • expression tag (174)
    Domains in SCOPe 2.06: d4i78d1, d4i78d2
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i78A (A:)
    adpgdricigyqanqnnqtvntlleqnvpvtgaqeiletnhngklcslngvppldlqsct
    lagwllgnpncdnlleaeewsyikinenapddlcfpgnfenlqdlllemsgvqnftkvkl
    fnpqsmtgvttnnvdqtcpfegkpsfyrnlnwiqgnsglpfnieiknptsnpllllwgih
    ntkdaaqqrnlygndysytifnfgekseefrpdigqrdeikahqdridyywgslpaqstl
    riestgnliapeygfyykrkegkgglmksklpisdcstkcqtplgalnstlpfqnvhqqt
    igncpkyvkatslmlatglrnnpqmegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i78A (A:)
    dricigyqanqnnqtvntlleqnvpvtgaqeiletnhngklcslngvppldlqsctlagw
    llgnpncdnlleaeewsyikinenapddlcfpgnfenlqdlllemsgvqnftkvklfnpq
    smtgvttnnvdqtcpfegkpsfyrnlnwiqgnsglpfnieiknptsnpllllwgihntkd
    aaqqrnlygndysytifnfgekseefrpdigqrdeikahqdridyywgslpaqstlries
    tgnliapeygfyykrkegkgglmksklpisdcstkcqtplgalnstlpfqnvhqqtignc
    pkyvkatslmlatglrnnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4i78B (B:)
    adpgdricigyqanqnnqtvntlleqnvpvtgaqeiletnhngklcslngvppldlqsct
    lagwllgnpncdnlleaeewsyikinenapddlcfpgnfenlqdlllemsgvqnftkvkl
    fnpqsmtgvttnnvdqtcpfegkpsfyrnlnwiqgnsglpfnieiknptsnpllllwgih
    ntkdaaqqrnlygndysytifnfgekseefrpdigqrdeikahqdridyywgslpaqstl
    riestgnliapeygfyykrkegkgglmksklpisdcstkcqtplgalnstlpfqnvhqqt
    igncpkyvkatslmlatglrnnpqmegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i78B (B:)
    dricigyqanqnnqtvntlleqnvpvtgaqeiletnhngklcslngvppldlqsctlagw
    llgnpncdnlleaeewsyikinenapddlcfpgnfenlqdlllemsgvqnftkvklfnpq
    smtgvttnnvdqtcpfegkpsfyrnlnwiqgnsglpfnieiknptsnpllllwgihntkd
    aaqqrnlygndysytifnfgekseefrpdigqrdeikahqdridyywgslpaqstlries
    tgnliapeygfyykrkegkgglmksklpisdcstkcqtplgalnstlpfqnvhqqtignc
    pkyvkatslmlatglrnnp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4i78C (C:)
    glfgaiagfieggwqgmidgwygyhhenqegsgyaadkeatqkavdgitnkvnsiidkmn
    sqfesnikefnrlelriqhlsdrvddalldiwsyntellvllenertldfhdanvknlfe
    kvkaqlkdnaidegngcflllhkcnnscmddikngtykymdyreeshiekqkidsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i78C (C:)
    iagfieggwqgmidgwygyhhenqegsgyaadkeatqkavdgitnkvnsiidkmnsqfes
    nikefnrlelriqhlsdrvddalldiwsyntellvllenertldfhdanvknlfekvkaq
    lkdnaidegngcflllhkcnnscmddikngtykymdyreeshiekqkids
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4i78D (D:)
    glfgaiagfieggwqgmidgwygyhhenqegsgyaadkeatqkavdgitnkvnsiidkmn
    sqfesnikefnrlelriqhlsdrvddalldiwsyntellvllenertldfhdanvknlfe
    kvkaqlkdnaidegngcflllhkcnnscmddikngtykymdyreeshiekqkidsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i78D (D:)
    iagfieggwqgmidgwygyhhenqegsgyaadkeatqkavdgitnkvnsiidkmnsqfes
    nikefnrlelriqhlsdrvddalldiwsyntellvllenertldfhdanvknlfekvkaq
    lkdnaidegngcflllhkcnnscmddikngtykymdyreeshiekqkids