PDB entry 4i77

View 4i77 on RCSB PDB site
Description: Lebrikizumab Fab bound to IL-13
Class: immune system/cytokine
Keywords: immunoglobulin, immune system recognition, IMMUNE SYSTEM-CYTOKINE complex
Deposited on 2012-11-30, released 2013-02-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.18
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Lebrikizumab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4I77 (0-218)
  • Chain 'L':
    Compound: Lebrikizumab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4I77 (0-217)
    Domains in SCOPe 2.03: d4i77l1, d4i77l2
  • Chain 'Z':
    Compound: interleukin-13
    Species: Homo sapiens [TaxId:9606]
    Gene: IL13, NC30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4i77z_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4i77L (L:)
divmtqspdslsvslgeratincrasksvdsygnsfmhwyqqkpgqppklliylasnles
gvpdrfsgsgsgtdftltisslqaedvavyycqqnnedprtfgggtkveikrtvaapsvf
ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
stltlskadyekhkvyacevthqglsspvtksfnrgec

  • Chain 'Z':
    Sequence, based on SEQRES records: (download) 
    >4i77Z (Z:)
gpvppstalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsaie
ktqrmlsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregrfn

    Sequence, based on observed residues (ATOM records): (download) 
    >4i77Z (Z:)
talrelieelvnitqplcngsmvwsinltagmycaaleslinvsgcsaiektqrmlsgfc
phkvsagqfsslhvrdtkievaqfvkdlllhlkklfr