PDB entry 4i6f

View 4i6f on RCSB PDB site
Description: Selective & Brain-Permeable Polo-like Kinase-2 (Plk-2) Inhibitors that Reduce -Synuclein Phosphorylation in Rat Brain
Class: transferase/transferase inhibitor
Keywords: Polo-like kinase-2 (Plk-2), Synuclein, Parkinsons disease, Kinase Inhibitor, transferase-transferase inhibitor complex
Deposited on 2012-11-29, released 2013-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.24
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase PLK2
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK2, SNK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NYY3
      • engineered mutation (30)
      • engineered mutation (34)
      • engineered mutation (66)
      • engineered mutation (163)
      • engineered mutation (206)
      • engineered mutation (238)
      • engineered mutation (282)
    Domains in SCOPe 2.07: d4i6fa_
  • Heterogens: 1C7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i6fA (A:)
    mmhhhhhhhhshsgpeisriivdpttgkrysrgktlgkggfakcyemtdltnnkvyaaki
    iphsrvskphqrekidkeielhrilhhkhvvqfyhyfedkeniyilleycsrrsmahilk
    arkvltepevryylrqivsglkylheqeilhrdlklgnffinesmelkvgdfglaarlep
    lehrrrticgtpnylspevlnkqghgaesdiwalgcvmytmllgrppfettnlketyrsi
    rearytmpssllapakhliasmlsknpedrpslddiirhdfftqgftpdrlssscchtvp
    dfhlsspa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i6fA (A:)
    riivdpttgkrysrgktlgkggfakcyemtdltnnkvyaakiiphsrvskphqrekidke
    ielhrilhhkhvvqfyhyfedkeniyilleycsrrsmahilkarkvltepevryylrqiv
    sglkylheqeilhrdlklgnffinesmelkvgdfglaarleplehrrrticgtpnylspe
    vlnkqghgaesdiwalgcvmytmllgrppfettnlketyrsirearytmpssllapakhl
    iasmlsknpedrpslddiirhdfftqgftpdrlssscchtvpdfh