PDB entry 4i60

View 4i60 on RCSB PDB site
Description: Crystal structure of avidin - biotinylruthenocene complex
Class: Biotin-binding protein
Keywords: Beta barrel, Biotin-binding protein, Biotinylruthenocene, Glycoprotein, Hen egg white
Deposited on 2012-11-29, released 2013-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.167
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (0-127)
      • see remark 999 (25)
      • see remark 999 (33)
    Domains in SCOPe 2.07: d4i60a_
  • Heterogens: B1R, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i60A (A:)
    arkcsltgkwtndlgsnmtigavnskgeftgtyttavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke