PDB entry 4i60

View 4i60 on RCSB PDB site
Description: Crystal structure of avidin - biotinylruthenocene complex
Class: Biotin-binding protein
Keywords: Beta barrel, Biotin-binding protein, Biotinylruthenocene, Glycoprotein, Hen egg white
Deposited on 2012-11-29, released 2013-08-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Avidin
  Species: Gallus gallus [TaxId:9031]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02701 (0-127)
    • see remark 999 (25)
    • see remark 999 (33)
  Domains in SCOPe 2.08: d4i60a_
• Heterogens: B1R, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4i60A (A:)
  arkcsltgkwtndlgsnmtigavnskgeftgtyttavtatsneikesplhgtqntinkrt
  qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
  trlrtqke