PDB entry 4i5b

View 4i5b on RCSB PDB site
Description: Structure of human MHC class II protein HLA-DR1 carrying an influenza hemagglutinin peptide partially filling the binding groove
Class: Immune system
Keywords: Immunoglobulin fold, Antigen presentation, peptide-MHC complex, membrane, Immune system
Deposited on 2012-11-28, released 2013-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hla class II histocompatibility antigen, dr alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DRA, HLA-DRA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01903 (0-End)
      • conflict (63)
    Domains in SCOPe 2.07: d4i5ba1, d4i5ba2
  • Chain 'B':
    Compound: HLA class II histocompatibility antigen, DRB1-1 beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DRB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04229 (0-191)
      • conflict (28)
    Domains in SCOPe 2.07: d4i5bb1, d4i5bb2
  • Chain 'C':
    Compound: truncated hemagglutinin peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 4I5B (0-11)
  • Chain 'D':
    Compound: hla class II histocompatibility antigen, dr alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DRA, HLA-DRA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01903 (0-186)
      • conflict (63)
    Domains in SCOPe 2.07: d4i5bd1, d4i5bd2
  • Chain 'E':
    Compound: HLA class II histocompatibility antigen, DRB1-1 beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DRB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04229 (0-End)
      • conflict (28)
    Domains in SCOPe 2.07: d4i5be1, d4i5be2
  • Chain 'F':
    Compound: truncated hemagglutinin peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 4I5B (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i5bA (A:)
    keehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgala
    niacdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtw
    lrngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
    apsplpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i5bA (A:)
    keehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgala
    niacdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtw
    lrngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i5bB (B:)
    dtrprflwqlkfechffngtervrllersiynqeesvrfdsdvgeyravtelgrpdaeyw
    nsqkdlleqrraavdtycrhnygvgesftvqrrvepkvtvypsktqplqhhnllvcsvsg
    fypgsievrwfrngqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsvt
    spltvewrarse
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i5bD (D:)
    keehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgala
    niacdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtw
    lrngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
    apsplpe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4i5bE (E:)
    dtrprflwqlkfechffngtervrllersiynqeesvrfdsdvgeyravtelgrpdaeyw
    nsqkdlleqrraavdtycrhnygvgesftvqrrvepkvtvypsktqplqhhnllvcsvsg
    fypgsievrwfrngqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsvt
    spltvewrarse
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i5bE (E:)
    dtrprflwqlkfechffngtervrllersiynqeesvrfdsdvgeyravtelgrpdaeyw
    nsqkdlleqrraavdtycrhnygvgesftvqrrvepkvtvypsktqplqhhnllvcsvsg
    fypgsievrwfrngqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsvt
    spltvewrar
    

  • Chain 'F':
    No sequence available.